PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G142000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 283aa    MW: 31007.5 Da    PI: 6.5003
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G142000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.6e-191966148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT +Ed+llvd v+q+G g+W+++++  g++R++k+c++rw +yl
  Sobic.006G142000.1.p 19 KGPWTSQEDKLLVDHVRQHGEGRWNSVSKIAGLKRSGKSCRLRWVNYL 66
                          79********************************************97 PP

2Myb_DNA-binding54.23.3e-1772116147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Sobic.006G142000.1.p  72 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 116
                           8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8461466IPR017930Myb domain
SuperFamilySSF466891.69E-2917113IPR009057Homeodomain-like
SMARTSM007171.8E-151868IPR001005SANT/Myb domain
PfamPF002493.7E-171966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-232073IPR009057Homeodomain-like
CDDcd001671.24E-112166No hitNo description
PROSITE profilePS5129425.39667121IPR017930Myb domain
SMARTSM007176.6E-1671119IPR001005SANT/Myb domain
PfamPF002491.0E-1472116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2474119IPR009057Homeodomain-like
CDDcd001678.62E-1176117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MEGPLGCWGR QEEVDGWRKG PWTSQEDKLL VDHVRQHGEG RWNSVSKIAG LKRSGKSCRL  60
RWVNYLRPDL KRGKITPQEE SIIVQLHALW GNRWSTIARS LPGRTDNEIK NYWRTHFKKG  120
KPSKNIERAR ARFLKQRQEM MQQQQQQSLI VGQQLNEDGD QRRGTCCTGT GATADDDDRG  180
SATGGDACAA PTTTTVATEA AGDLTTIMHD DDAMDCFIMC PMSCDDLGLV LHGAAAGGQR  240
GGTGSCCGST ASDEYRSSEE DGGATWGSLW NLDGAGEVCT LW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261911927126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-108AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664226.11e-119PREDICTED: myb-related protein 330-like
TrEMBLK3Y9D01e-112K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-65myb domain protein 79